Frog corticotropin-releasing hormone (CRH): Isolation, molecular cloning, and biological activity

  • Reiko Okada
  • , Yoichi Ito
  • , Miyoko Kaneko
  • , Kazutoshi Yamamoto
  • , Nicolas Chartrel
  • , J. Michael Conlon
  • , Hubert Vaudry
  • , Sakae Kikuyama

Research output: Contribution to journalArticlepeer-review

Abstract

Corticotropin-releasing hormone (CRH) was isolated from the brain of the European green frog, Rana esculenta, by combining HPLC purification with radioimmunoassay (RIA) detection. The amino acid sequence SEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII was identical with the sequence of bullfrog (R. catesbeiana) CRH that was deduced from a cDNA encoding the CRH precursor. Synthetic frog CRH enhanced the release of thyroid-stimulating hormone (TSH) from dispersed bullfrog pituitary cells in a concentration- dependent manner. The TSH-releasing activity of a bullfrog hypothalamic extract was decreased by approximately 45% in the presence of the CRH receptor antagonist, α-helical CRH9-41, suggesting that CRH is one of the main TSH-releasing factors present in the bullfrog hypothalamus.

Original languageEnglish
Pages (from-to)150-155
Number of pages6
JournalAnnals of the New York Academy of Sciences
Volume1040
DOIs
Publication statusPublished - 2005
Externally publishedYes

Keywords

  • Bullfrog
  • CRH
  • TSH
  • TSH-releasing factor

ASJC Scopus subject areas

  • General Neuroscience
  • General Biochemistry,Genetics and Molecular Biology
  • History and Philosophy of Science

Fingerprint

Dive into the research topics of 'Frog corticotropin-releasing hormone (CRH): Isolation, molecular cloning, and biological activity'. Together they form a unique fingerprint.

Cite this